General Information

  • ID:  hor000859
  • Uniprot ID:  Q5NRQ0
  • Protein name:  Endothelin-2
  • Gene name:  EDN2
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  Endothelin/sarafotoxin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031708 endothelin B receptor binding
  • GO BP:  GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0014826 vein smooth muscle contraction; GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CSCSSWLDKECVYFCHLDIIW
  • Length:  21(49-69)
  • Propeptide:  MVAMPTAWCSIALALLLALHEGKGQVAAAPDQPAPSHRARASHLRPRRCSCSSWLDKECVYFCHLDIIWVNTPGQTAPYGLGNPPRRRRRSLPKRCECSSGRDPACATFCHRRPKPEAVVVPGSGPPPDVFQAGRARPSAGELLQQLRDISAAKSHFARRQQVAVRELRPTHSRRWKR
  • Signal peptide:  MVAMPTAWCSIALALLLALHEGKGQV
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endothelium-derived vasoconstrictor peptides
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  EDNRB, EDNRA
  • Target Unid:   A0A337SDI4, M3WMJ5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-O15130-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O15130-F1.pdbhor000859_AF2.pdbhor000859_ESM.pdb

Physical Information

Mass: 290790 Formula: C115H164N26O32S4
Absent amino acids: AGMNPQRT Common amino acids: C
pI: 4.37 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: 50 Boman Index: -832
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 88.1
Instability Index: 6531.9 Extinction Coefficient cystines: 12740
Absorbance 280nm: 637

Literature

  • PubMed ID:  NA
  • Title:  NA